PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002093.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 82aa    MW: 9066.16 Da    PI: 8.8721
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002093.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.8e-322580258
              ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                             ++vrY eC++NhAa+lGg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRre++
  Itr_sc002093.1_g00004.1 25 NNVRYVECQRNHAANLGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREEQ 80
                             689**************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-132578IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.7E-312679IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.0E-272878IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.0122978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MKKTKVVVRR DMTRRNTGAP GTTNNNVRYV ECQRNHAANL GGYAVDGCRE FMASGEEGTT  60
AALTCAACGC HRNFHRREEQ SC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800036.12e-39PREDICTED: mini zinc finger protein 3-like
SwissprotQ9CA517e-30MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A068U1653e-35A0A068U165_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00810.t012e-32(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.13e-20mini zinc finger